{"product_id":"proteintech-67726-1-ig","title":"Proteintech, 67726-1-Ig, Cyclin B2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cyclin B2 (67726-1-Ig) by Proteintech is a Monoclonal antibody targeting Cyclin B2 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse samples\n67726-1-Ig targets Cyclin B2 in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: DU 145 cells, HeLa cells,  K-562 cells,  Jurkat cells,  HEK-293 cells,  U2OS cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\nPositive IF\/ICC detected in: PC-12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCyclin B2 (CCNB2) is a member of cyclin family proteins, which regulate the activities of cyclin dependent kinases (CDKs) and different cyclins function spatially and temporally in specific phases of the cell cycle. Cyclin B2 serves a key role in progression of G2\/M transition. Cyclin B2 has been found to be up-regulated in a variety of human cancers, such as adrenocortical carcinoma, breast carcinoma, colorectal adenocarcinoma, pituitary adenoma and gastric cancer. The aberrant expression of Cyclin B2 deregulates spindle checkpoints in the cell cycle and results in chromosomal instability (CIN), one of the signature phenotypes of most cancers. Moreover, serum circulating Cyclin B2 mRNA expression has been found increased in cancer patients and associated with cancer stage and metastasis status.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag16329 Product name: Recombinant human CCNB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-243 aa of BC105086 Sequence: MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTS Predict reactive species\nFull Name: cyclin B2\nCalculated Molecular Weight: 398 aa, 45 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC105086\nGene Symbol: Cyclin B2\nGene ID (NCBI): 9133\nRRID: AB_2882912\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O95067\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888060321961,"sku":"67726-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67726-1-ig","provider":"Iright","version":"1.0","type":"link"}