{"product_id":"proteintech-67736-1-ig","title":"Proteintech, 67736-1-Ig, PTGES3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PTGES3 (67736-1-Ig) by Proteintech is a Monoclonal antibody targeting PTGES3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples\n67736-1-Ig targets PTGES3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  PC-3 cells,  HepG2 cells,  HSC-T6 cells,  NIH\/3T3 cells,  pig brain tissue\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nP23, encoded by the gene PTGES3, plays a key role in glucocorticoid signaling and was increased at the mRNA level in the DLPFC in individuals with schizophrenia (PMID: 24345775). In the GR heterocomplex in vitro, p23 is an obligatory co-factor19 and is the limiting component of the complex44, functioning to stabilize the interaction of the complex with GR in the cytoplasm. Paradoxically, p23 also acts in the nucleus to inhibit GR-mediated gene transcription and disassemble GR transcriptional machinery in the nucleus (PMID: 12077419). In vivo, p23 is critical for appropriate glucocorticoid responsiveness (PMID: 17000766).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7870 Product name: Recombinant human PTGES3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-160 aa of BC003005 Sequence: MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE Predict reactive species\nFull Name: prostaglandin E synthase 3 (cytosolic)\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC003005\nGene Symbol: PTGES3\nGene ID (NCBI): 10728\nRRID: AB_2918505\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q15185\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888001437865,"sku":"67736-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67736-1-ig","provider":"Iright","version":"1.0","type":"link"}