{"product_id":"proteintech-67742-1-ig","title":"Proteintech, 67742-1-Ig, ACADM Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ACADM (67742-1-Ig) by Proteintech is a Monoclonal antibody targeting ACADM in WB, IHC, IF-P, ELISA applications with reactivity to human, rat, pig samples\n67742-1-Ig targets ACADM in WB, IHC, IF-P, ELISA applications and shows reactivity with human, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, HSC-T6 cells,  rat liver tissue,  HeLa cells,  HEK-293 cells,  HepG2 cells\nPositive IHC detected in: human liver tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human liver cancer tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nACADM, also named as MCAD, belongs to the acyl-CoA dehydrogenase family.  This enzyme is specific for acyl chain lengths of 4 to 16. It catalyzes the reaction: Acyl-CoA + acceptor = 2,3-dehydroacyl-CoA + reduced acceptor.  Defects in ACADM are the cause of medium-chain acyl-CoA dehydrogenase deficiency (MCAD deficiency). This protein can exsit as a dimer(PMID:8962055). This antibody is specific to ACADM.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat, pig\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30620 Product name: Recombinant human ACADM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 205-352 aa of BC005377 Sequence: ARSDPDPKAPANKAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTY Predict reactive species\nFull Name: acyl-Coenzyme A dehydrogenase, C-4 to C-12 straight chain\nCalculated Molecular Weight: 421 aa, 47 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC005377\nGene Symbol: ACADM\nGene ID (NCBI): 34\nRRID: AB_2918511\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P11310\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888017690793,"sku":"67742-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67742-1-ig","provider":"Iright","version":"1.0","type":"link"}