{"product_id":"proteintech-67774-1-ig","title":"Proteintech, 67774-1-Ig, KLHL25 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe KLHL25 (67774-1-Ig) by Proteintech is a Monoclonal antibody targeting KLHL25 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n67774-1-Ig targets KLHL25 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HT-29 cells,  HepG2 cells,  NCCIT cells,  MOLT-4 cells,  Raji cells,  Ramos cells,  Daudi cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag27037 Product name: Recombinant human KLHL25 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 162-260 aa of BC028100 Sequence: RRLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFEAILQWVKHDLEPRKVHLPELLRSVRLALLPSDCLQEAVSSEALLMADE Predict reactive species\nFull Name: kelch-like 25 (Drosophila)\nObserved Molecular Weight: 66 kDa\nGenBank Accession Number: BC028100\nGene Symbol: KLHL25\nGene ID (NCBI): 64410\nRRID: AB_2918539\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9H0H3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888288944297,"sku":"67774-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67774-1-ig","provider":"Iright","version":"1.0","type":"link"}