{"product_id":"proteintech-67783-1-ig","title":"Proteintech, 67783-1-Ig, PPP2R2A\/B\/C Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPP2R2A\/B\/C (67783-1-Ig) by Proteintech is a Monoclonal antibody targeting PPP2R2A\/B\/C in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n67783-1-Ig targets PPP2R2A\/B\/C in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, pig brain tissue,  LNCaP cells,  HeLa cells,  Jurkat cells,  K-562 cells,  rabbit brain tissue,  rat brain tissue,  mouse brain tissue\nPositive IHC detected in: mouse brain tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe PPP2R2B gene encodes a deduced 443 amino acid protein of approximately 52 kDa, which is a brain-specific regulatory subunit B of protein phosphatase 2. PPP2R2B is a Subunit of PP2A, a highly conserved constitutive enzyme(PMID:11719278). PPP2R2B (Bβ) is an important regulator of protein phosphatase 2A (PP2A) activity in the brain. Through differential promoter usage and alternative splicing, two major isoforms Bβ1 and Bβ2 with divergent sub-cellular targeting N termini are produced. Bβ plays an important role in neuronal survival. It has 5 isoforms produced by alternative splicing. This antibody can recognize PPP2R2A and PPP2R2C due to the immunogen of PPP2R2B having high homology with PPP2R2A and PPP2R2C.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30774 Product name: Recombinant human PPP2R2B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 290-443 aa of BC031790 Sequence: SHSGRYIMTRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGSYNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAWHPSENIIAVAATNNLYIFQDKVN Predict reactive species\nFull Name: protein phosphatase 2 (formerly 2A), regulatory subunit B, beta isoform\nCalculated Molecular Weight: 443 aa, 52 kDa\nObserved Molecular Weight: 52 kDa\nGenBank Accession Number: BC031790\nGene Symbol: PPP2R2B\nGene ID (NCBI): 5521\nRRID: AB_2918547\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q00005\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888071659689,"sku":"67783-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67783-1-ig","provider":"Iright","version":"1.0","type":"link"}