{"product_id":"proteintech-67790-1-ig","title":"Proteintech, 67790-1-Ig, IFI16 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe IFI16 (67790-1-Ig) by Proteintech is a Monoclonal antibody targeting IFI16 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human samples\n67790-1-Ig targets IFI16 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HeLa cells,  MOLT-4 cells,  Ramos cells,  Daudi cells\nPositive IHC detected in: human tonsillitis tissue, human renal cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIFI16 is a member of a family of interferon-inducible nuclear proteins involved in transcriptional regulation functions as a transcriptional repressor. IFI16 may be involved in TP53-mediated transcriptional activation by enhancing TP53 sequence-specific DNA binding and modulating TP53 phosphorylation status. It has been reported that IFI16 participates in the regulation of autophagy, TP53-mediated cell death and innate immune response. IFI16 has different isoforms and 67790-1-Ig antibody detects proteins around 85-95 kDa in SDS-PAGE similar to papers. (PMID: 9718316, 14990579, 11146555, 22046441)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30314 Product name: Recombinant human IFI16 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 580-729 aa of BC017059 Sequence: VCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF Predict reactive species\nFull Name: interferon, gamma-inducible protein 16\nCalculated Molecular Weight: 729 aa, 82 kDa\nObserved Molecular Weight: 85-95 kDa\nGenBank Accession Number: BC017059\nGene Symbol: IFI16\nGene ID (NCBI): 3428\nRRID: AB_2918554\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q16666\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888043511977,"sku":"67790-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67790-1-ig","provider":"Iright","version":"1.0","type":"link"}