{"product_id":"proteintech-67791-1-ig","title":"Proteintech, 67791-1-Ig, AIF Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe AIF (67791-1-Ig) by Proteintech is a Monoclonal antibody targeting AIF in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig, canine samples\n67791-1-Ig targets AIF in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, canine samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HeLa cells,  HEK-293 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH-3T3 cells,  MDCK cells,  Pig brain cells\nPositive IHC detected in: human kidney tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human kidney tissue\nPositive IF\/ICC detected in: HeLa cells, HCT 116 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nApoptosis-inducing factor (AIF) is one of the mitochondrial proteins to be released into the cytosol during apoptosis, and it is discovered as the first protein that regulates caspase-independent apoptosis(PMID:20494118). AIF is encoded as a 67 kDa protein that contains a mitochondrial localization signal (MLS) in the N-terminus.It is cleaved from the 62 kDa to the 57 kDa form following ischemic injury and translocated from the mitochondria to the nucleus in a calpain-dependent manner(PMID:19332058).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, canine\nCited Reactivity: human, rat, pig\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag12400 Product name: Recombinant human AIF protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 259-609 aa of BC111065 Sequence: TPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED Predict reactive species\nFull Name: apoptosis-inducing factor, mitochondrion-associated, 1\nCalculated Molecular Weight: 609 aa, 66 kDa\nObserved Molecular Weight: 67 kDa, 57 kDa\nGenBank Accession Number: BC111065\nGene Symbol: AIF\nGene ID (NCBI): 9131\nRRID: AB_2918555\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O95831\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888009138345,"sku":"67791-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67791-1-ig","provider":"Iright","version":"1.0","type":"link"}