{"product_id":"proteintech-67797-1-ig","title":"Proteintech, 67797-1-Ig, MFG-E8 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe MFG-E8 (67797-1-Ig) by Proteintech is a Monoclonal antibody targeting MFG-E8 in WB, IHC, ELISA applications with reactivity to Human samples\n67797-1-Ig targets MFG-E8 in WB, IHC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human milk, human placenta tissue\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:4000-1:16000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMilk fat globule-epidermal growth factor-factor 8 (MFG-E8), also known as lactadherin, is a multifunctional secreted glycoprotein exhibiting versatile functions in cell physiology affecting health and diseases. It plays roles in clearance of apoptotic cells, anti-inflammatory, wound healing, arterial remodeling, angiogenesis, enhancing tumorigenicity and cancer metastasis (PMID: 23972256).  MFG-E8 consists of two-repeated EGF-likedomains, a mucin-like domain and two-repeated discoidin-like domains (C-domains), and contains an integrin-binding motif (RGD sequence) in the EGF-like domain (PMID: 11856354). It shows ubiquitous pattern of expression in various types of cells and tissues. Altered expression of MFG-E8 causes disruptions of homeostasis and is correlated with a number of diseases (PMID: 27429513).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30666 Product name: Recombinant human MFGE8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 24-335 aa of BC003610 Sequence: LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC Predict reactive species\nFull Name: milk fat globule-EGF factor 8 protein\nCalculated Molecular Weight: 43 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC003610\nGene Symbol: MFGE8\nGene ID (NCBI): 4240\nRRID: AB_2918561\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q08431\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888292810921,"sku":"67797-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67797-1-ig","provider":"Iright","version":"1.0","type":"link"}