{"product_id":"proteintech-67806-1-ig","title":"Proteintech, 67806-1-Ig, PKMYT1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PKMYT1 (67806-1-Ig) by Proteintech is a Monoclonal antibody targeting PKMYT1 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples\n67806-1-Ig targets PKMYT1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, MCF-7 cells,  HeLa cells,  HEK-293 cells,  Jurkat cells,  K-562 cells,  PC-12 cells,  HSC-T6 cells,  4T1 cells,  NIH\/3T3 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtein kinase, membrane associated tyrosine\/threonine (PKMYT1) is a member of the Wee family of protein kinases. PKMYT1 acts as a negative regulator of the cell cycle by inactivating the CDK1-cyclinB complex through phosphorylation of Tyr14\/Tyr15 and preventing cell cycle entering into mitosis at the G2\/M transition. In mammalian somatic cells, PKMYT1 affects the assembly of the Golgi apparatus and endoplasmic reticulum during telophase of mitosis by inhibiting cyclin activities. Abnormal expression of PKMYT1 is closely associated with multiple types of cancers. PKMYT1 protein was mainly localized in the cytoplasm. (PMID: 31695486, PMID: 32801781)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30849 Product name: Recombinant human PKMYT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-180 aa of NM_004203 Sequence: MLERPPALAMPMPTEGTPPPLSGTPIPVPAYFRHAEPGFSLKRPRGLSRSLPPPPPAKGSIPISRLFPPRTPGWHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRSKEDGRLYAVKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEG Predict reactive species\nFull Name: protein kinase, membrane associated tyrosine\/threonine 1\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: NM_004203\nGene Symbol: PKMYT1\nGene ID (NCBI): 9088\nRRID: AB_2918569\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q99640\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888032010409,"sku":"67806-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67806-1-ig","provider":"Iright","version":"1.0","type":"link"}