{"product_id":"proteintech-67808-1-ig","title":"Proteintech, 67808-1-Ig, SMCR7L\/MID51 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMCR7L\/MID51 (67808-1-Ig) by Proteintech is a Monoclonal antibody targeting SMCR7L\/MID51 in WB, IHC, IF-P, ELISA applications with reactivity to Human, mouse , rat samples\n67808-1-Ig targets SMCR7L\/MID51 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, mouse , rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HeLa cells,  HEK-293 cells,  Jurkat cells,  K-562 cells,  PC-12 cells,  NIH\/3T3 cells,  4T1 cells,  HSC-T6 cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman SMCR7L gene encodes, MID51, the mitochondrial dynamic protein of 51 kDa (also called mitochondrial elongation factor 1, MIEF1). MID51 is a single-pass membrane protein anchored to the mitochondrial outer membrane and regulates mitochondrial morphology. Mitochondrial morphology is controlled by two opposing processes: fusion and fission. Elevated MID51 levels induce extensive mitochondrial fusion, whereas depletion of MID51 causes mitochondrial fragmentation. MID51 interacts with and recruits Drp1 to mitochondria, suggesting a critical role of MID51 in regulation of mitochondrial fusion-fission machinery in vertebrates.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse , rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag13775 Product name: Recombinant human SMCR7L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-359 aa of BC002587 Sequence: FDTDTFCPPRPKPVARKGQVDLKKSRLRMSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQT Predict reactive species\nFull Name: Smith-Magenis syndrome chromosome region, candidate 7-like\nCalculated Molecular Weight: 463 aa, 51 kDa\nObserved Molecular Weight: 48-51 kDa\nGenBank Accession Number: BC002587\nGene Symbol: SMCR7L\nGene ID (NCBI): 54471\nRRID: AB_2918571\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NQG6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888049934505,"sku":"67808-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67808-1-ig","provider":"Iright","version":"1.0","type":"link"}