{"product_id":"proteintech-67829-1-ig","title":"Proteintech, 67829-1-Ig, TOE1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TOE1 (67829-1-Ig) by Proteintech is a Monoclonal antibody targeting TOE1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human samples\n67829-1-Ig targets TOE1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  HEK-293 cells,  HepG2 cells,  Jurkat cells,  K-562 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTOE1, also known as hCaf1z, belongs to the DEDD family of deadenylases. TOE1 was initially identified as a direct target gene of ERG1, an immediate early transcription factor. TOE1 encodes an Asp-Glu-Asp-Asp deadenylase that specifically localizes to Cajal bodies in the nucleus, where assembly and maturation of small nuclear ribonucleoprotein particles, and telomerase ribonucleoprotein complex take place (PMID: 36257135). TOE1 has 2 isoforms with the molecular mass of 48 and 57 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28982 Product name: Recombinant human TOE1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-262 aa of BC009364 Sequence: MAADSDDGAVSAPAASDGGVSKSTTSGEELVVQVPVVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGLGDRKSLLNQCIEERYKAVCHAARTRSILSLGLACFKRQPDKGEHSYLAQVFNLTLLCMEEYVIEPKSVQFLIQHGFNFNQQYAQGIPYHKGNDKGDESQSQSVRTLFLELIRARRPLVLHNGLIDLVFLYQNFYAHLPESLGTFTADLCEMFPAGIYDTKYAAEFHARFVASYLEYAFRKCERENGKQRAAG Predict reactive species\nFull Name: target of EGR1, member 1 (nuclear)\nCalculated Molecular Weight: 510 aa, 57 kDa\nObserved Molecular Weight: 57 kDa\nGenBank Accession Number: BC009364\nGene Symbol: TOE1\nGene ID (NCBI): 114034\nRRID: AB_2918591\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96GM8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888331968681,"sku":"67829-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67829-1-ig","provider":"Iright","version":"1.0","type":"link"}