{"product_id":"proteintech-67839-1-ig","title":"Proteintech, 67839-1-Ig, MED4 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe MED4 (67839-1-Ig) by Proteintech is a Monoclonal antibody targeting MED4 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, Mouse, rat samples\n67839-1-Ig targets MED4 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, Mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, Hela,  HEK-293,  Jurkat,  K-562,  HSC-T6,  PC-12,  NIH\/3T3,  4T1\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMED4 is a component of the Meditor complex, which is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Meditor functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. It also have an alternative name called \"Activator-recruited cofactor 36 kDa component (ARC36) \".\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8562 Product name: Recombinant human MED4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-270 aa of BC005189 Sequence: MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDGDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKEDEDDVEIMSTDSSSSSSESD Predict reactive species\nFull Name: mediator complex subunit 4\nCalculated Molecular Weight: 270 aa, 30 kDa\nObserved Molecular Weight: ~36 kDa\nGenBank Accession Number: BC005189\nGene Symbol: MED4\nGene ID (NCBI): 29079\nRRID: AB_2918601\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NPJ6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888292188329,"sku":"67839-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67839-1-ig","provider":"Iright","version":"1.0","type":"link"}