{"product_id":"proteintech-67862-1-ig","title":"Proteintech, 67862-1-Ig, GSTM1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe GSTM1 (67862-1-Ig) by Proteintech is a Monoclonal antibody targeting GSTM1 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig, chicken samples\n67862-1-Ig targets GSTM1 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, chicken samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat liver tissue, chicken liver tissue,  HeLa cells,  Jurkat cells,  mouse liver tissue,  pig liver tissue\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, chicken\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag3113 Product name: Recombinant human GSTM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-181 aa of BC024005 Sequence: MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKGLEKISAYMKSSRFLPRPVFSKMAVWGNK Predict reactive species\nFull Name: glutathione S-transferase mu 1\nCalculated Molecular Weight: 181 aa, 21 kDa\nObserved Molecular Weight: 26-28 kDa\nGenBank Accession Number: BC024005\nGene Symbol: GSTM1\nGene ID (NCBI): 2944\nRRID: AB_2918620\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P09488\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888281538729,"sku":"67862-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67862-1-ig","provider":"Iright","version":"1.0","type":"link"}