{"product_id":"proteintech-67866-1-ig","title":"Proteintech, 67866-1-Ig, CSNK2B Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CSNK2B (67866-1-Ig) by Proteintech is a Monoclonal antibody targeting CSNK2B in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, mouse, rat, pig samples\n67866-1-Ig targets CSNK2B in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, MCF-7 cells,  LNCaP cells,  HeLa cells,  Jurkat cells,  pig brain tissue,  rat brain tissue,  mouse brain tissue\nPositive IHC detected in: human breast cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:20000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCSNK2B is a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. It participates in Wnt signaling, and plays a complex role in regulating the basal catalytic activity of the alpha subunit.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag19180 Product name: Recombinant human CSNK2B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-215 aa of BC112017 Sequence: MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR Predict reactive species\nFull Name: casein kinase 2, beta polypeptide\nCalculated Molecular Weight: 215 aa, 25 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC112017\nGene Symbol: CSNK2B\nGene ID (NCBI): 1460\nRRID: AB_2918624\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P67870\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888112324777,"sku":"67866-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67866-1-ig","provider":"Iright","version":"1.0","type":"link"}