{"product_id":"proteintech-67889-1-ig","title":"Proteintech, 67889-1-Ig, CDK7 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDK7 (67889-1-Ig) by Proteintech is a Monoclonal antibody targeting CDK7 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, mouse, rat samples\n67889-1-Ig targets CDK7 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, U2OS cells,  MCF-7 cells,  Hela cells,  Jurkat cells,  HEK-293 cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells,  4T1 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:750-1:3000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag25737 Product name: Recombinant human CDK7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 183-345 aa of BC005298 Sequence: LLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLI Predict reactive species\nFull Name: cyclin-dependent kinase 7\nCalculated Molecular Weight: 39 kDa\nObserved Molecular Weight: 39 kDa\nGenBank Accession Number: BC005298\nGene Symbol: CDK7\nGene ID (NCBI): 1022\nRRID: AB_2918645\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P50613\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888107475113,"sku":"67889-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67889-1-ig","provider":"Iright","version":"1.0","type":"link"}