{"product_id":"proteintech-67910-1-ig","title":"Proteintech, 67910-1-Ig, PSMA1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSMA1 (67910-1-Ig) by Proteintech is a Monoclonal antibody targeting PSMA1 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples\n67910-1-Ig targets PSMA1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, RAW 264.7 cells,  4T1 cells,  Hela cells,  HepG2 cells,  K-562 cells,  Jurkat cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPSMA1(Proteasome subunit alpha type-1) is also named as HC2, NU, PROS30, PSC2 and belongs to the peptidase T1A family.The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH.It is induced in breast cancer tissue and up-regulated in liver tumor tissues(PMID:17127214;16317774;17004105).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30527 Product name: Recombinant human PSMA1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-263 aa of BC015105 Sequence: MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH Predict reactive species\nFull Name: proteasome (prosome, macropain) subunit, alpha type, 1\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 29-33 kDa\nGenBank Accession Number: BC015105\nGene Symbol: PSMA1\nGene ID (NCBI): 5682\nRRID: AB_2918665\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P25786\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888314470569,"sku":"67910-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67910-1-ig","provider":"Iright","version":"1.0","type":"link"}