{"product_id":"proteintech-67915-1-ig","title":"Proteintech, 67915-1-Ig, DDX3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe DDX3 (67915-1-Ig) by Proteintech is a Monoclonal antibody targeting DDX3 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, rat samples\n67915-1-Ig targets DDX3 in WB, IHC, IF, FC (Intra), CoIP, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HepG2 cells,  HeLa cells,  HEK-293 cells,  Jurkat cells,  HSC-T6 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDDX3X, also named DBX, DDX3, and HLP2, belongs to the DEAD-box helicase family and DDX3\/DED1 subfamily. It is ATP-dependent RNA helicase. DDX3X acts as a cofactor for XPO1-mediated nuclear export of incompletely spliced HIV-1 Rev RNAs. It is also involved in HIV-1 replication. DDX3X interacts specifically with hepatitis C virus core protein resulting in a change in intracellular location. 73kd is the target band. 60-65kd is some other isoform. This antibody can bind both DDX3X and DDX3Y for the close sequences.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human, rat, hamster\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29972 Product name: Recombinant human DDX3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 312-662 aa of BC011819 Sequence: DLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN Predict reactive species\nFull Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked\nCalculated Molecular Weight: 73 kDa\nObserved Molecular Weight: 71-73 kDa\nGenBank Accession Number: BC011819\nGene Symbol: DDX3\nGene ID (NCBI): 1654\nRRID: AB_2918669\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O00571\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888019722409,"sku":"67915-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67915-1-ig","provider":"Iright","version":"1.0","type":"link"}