{"product_id":"proteintech-67923-1-ig","title":"Proteintech, 67923-1-Ig, DLK1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe DLK1 (67923-1-Ig) by Proteintech is a Monoclonal antibody targeting DLK1 in WB, IHC, ELISA applications with reactivity to human, pig samples\n67923-1-Ig targets DLK1 in WB, IHC, ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: JAR cells, human placenta tissue,  pig adrenal gland tissue,  NCCIT cells\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDLK1, also named PREF1, FA1, or pG2, is a transmembrane protein belonging to the epidermal growth factor (EGF)-like superfamily (PMID: 8095043). It contains six EGF-like repeats in the extracellular region. DLK1 is abundant in preadipocytes and regulate adipocyte differentiation negatively (PMID: 8500166). Deficiency of DLK1 gives rise to growth retardation and accelerated adiposity in mouse model. Expression of DLK1 is found in tumors with neuroendocrine features that implies DLK1 may be involved in neuroendocrine differentiation (PMID: 8095043). It has been reported overexpression of DLK1 could lead to the development of metabolic abnormalities by impairment of adipocyte function in mice (PMID: 12588883). The gene of DLK1 maps to chromosome 14q32, and encodes a 383-amino acid protein with a calculated molecular mass of 41 kDa. In preadipocytes, multiple discrete forms of DLK1 protein of 45-60 kDa are present, owing in part to N-linked glycosylation (PMID: 8500166).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30916 Product name: Recombinant human DLK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 242-383 aa of BC007741 Sequence: LTCVKKRALSPQQVTRLPNGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNHMLRKKKNLLLQYNSGEDLAVNIIFPEKIDMTTFSKEAGDEEI Predict reactive species\nFull Name: delta-like 1 homolog (Drosophila)\nCalculated Molecular Weight: 41 kDa\nObserved Molecular Weight: 45-60 kDa\nGenBank Accession Number: BC007741\nGene Symbol: DLK1\nGene ID (NCBI): 8788\nRRID: AB_2918675\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P80370\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887978926249,"sku":"67923-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67923-1-ig","provider":"Iright","version":"1.0","type":"link"}