{"product_id":"proteintech-67943-1-ig","title":"Proteintech, 67943-1-Ig, ATG16L1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATG16L1 (67943-1-Ig) by Proteintech is a Monoclonal antibody targeting ATG16L1 in WB, IF\/ICC, ELISA applications with reactivity to Human, mouse, rat samples\n67943-1-Ig targets ATG16L1 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HSC-T6 cells, HepG2 cells,  rat lung tissue,  PC-12 cells,  NIH\/3T3 cells,  4T1 cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman ATG16L1 is a 607 amino acid protein (~68 kDa) comprising three major domains: the N‐terminal ATG5 binding domain (ATG5‐BD), the central coiled‐coil domain (CCD) and a predicted C‐terminal WD40‐domain. ATG16L1α and β (Atg16L1α, 63 kDa; and Atg16L1β, 71 kDa) are the major isoforms expressed in intestinal epithelium and macrophages , and all isoforms encode exon 9, which contains Thr 300. Atg16L1 mediates the cellular degradative process of autophagy and is considered a critical regulator of inflammation based on its genetic association with inflammatory bowel disease. ATG16L1 has been implicated in Crohn's disease. (PMID: 24553140, PMID: 22740627,PMID: 28685931)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nCited Reactivity: human, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag14881 Product name: Recombinant human ATG16L1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 258-607 aa of BC000061 Sequence: RAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDAHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSRHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY Predict reactive species\nFull Name: ATG16 autophagy related 16-like 1 (S. cerevisiae)\nCalculated Molecular Weight: 607 aa, 68 kDa\nObserved Molecular Weight: 68-75 kDa\nGenBank Accession Number: BC000061\nGene Symbol: ATG16L1\nGene ID (NCBI): 55054\nRRID: AB_2918695\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q676U5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887992623273,"sku":"67943-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67943-1-ig","provider":"Iright","version":"1.0","type":"link"}