{"product_id":"proteintech-67956-1-ig","title":"Proteintech, 67956-1-Ig, Caspase 7 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Caspase 7 (67956-1-Ig) by Proteintech is a Monoclonal antibody targeting Caspase 7 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples\n67956-1-Ig targets Caspase 7 in WB, IHC, IF, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, PC-12 cells,  RAW 264.7 cells\nPositive IHC detected in: rat stomach tissue, human liver cancer tissue,  mouse liver tissue,  mouse stomach tissue,  rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCaspase 7(CASP7), like caspases 3 and 6, contains a short prodomain and, upon apoptotic induction, the 35 kDa proform is converted into a 32 kDa intermediate or preactive form which is further processed into two active subunits consisting of the p20 or large (18 kDa) subunit and the p10 or small (11 kDa) subunit and it is present in the brain, which is up-regulated and activated after traumatic injury(PMID:15953353). Caspase-7 is classified as a member of the subgroup of cysteine proteases most related to the Caenorhabditis elegans factor CED-3, which also includes caspase-3, -6, and -9(PMID:9426061). The protein is involved in the activation cascade of caspases responsible for apoptosis execution.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag27601 Product name: Recombinant human Caspase 7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-100 aa of BC015799 Sequence: MADEQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKC Predict reactive species\nFull Name: caspase 7, apoptosis-related cysteine peptidase\nCalculated Molecular Weight: 303 aa, 34 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC015799\nGene Symbol: Caspase 7\nGene ID (NCBI): 840\nRRID: AB_2918707\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P55210\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888037974185,"sku":"67956-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67956-1-ig","provider":"Iright","version":"1.0","type":"link"}