{"product_id":"proteintech-67960-1-ig","title":"Proteintech, 67960-1-Ig, ABCE1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ABCE1 (67960-1-Ig) by Proteintech is a Monoclonal antibody targeting ABCE1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, Mouse, Rat samples\n67960-1-Ig targets ABCE1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, A431 cells,  U2OS cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells,  4T1 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nABCE1 is an ATPase that is a member of the ATP-binding cassette (ABC) transporters superfamily and OABP subfamily, it is an essential and highly conserved protein that is required for both eukaryotic translation initiation as well as ribosome biogenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28493 Product name: Recombinant human ABCE1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 76-256 aa of BC016283 Sequence: PSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTALKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAA Predict reactive species\nFull Name: ATP-binding cassette, sub-family E (OABP), member 1\nCalculated Molecular Weight: 599 aa, 67 kDa\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC016283\nGene Symbol: ABCE1\nGene ID (NCBI): 6059\nRRID: AB_2918711\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P61221\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888080998569,"sku":"67960-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67960-1-ig","provider":"Iright","version":"1.0","type":"link"}