{"product_id":"proteintech-67961-1-ig","title":"Proteintech, 67961-1-Ig, CCT6B Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCT6B (67961-1-Ig) by Proteintech is a Monoclonal antibody targeting CCT6B in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n67961-1-Ig targets CCT6B in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, NIH\/3T3 cells,  HSC-T6 cells,  HEK-293 cells,  K-562 cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\nPositive FC (Intra) detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCT6B, also named as CCT-zeta-2, TCP-1-zeta-like, CCT-zeta-like, Testis-specific Tcp20 and Testis-specific protein TSA303, belongs to the TCP-1 chaperonin family. CCT6B is a molecular chaperone which assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin. CCT6B has 3 isoforms with the molecular mass of 53-58 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag31295 Product name: Recombinant human CCT6B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 231-530 aa of BC027591 Sequence: LICNVSLEYEKTEVNSGFFYKTAEEKEKLVKAERKFIEDRVQKIIDLKDKVCAQSNKGFVVINQKGIDPFSLDSLAKHGIVALRRAKRRNMERLSLACGGMAVNSFEDLTVDCLGHAGLVYEYTLGEEKFTFIEECVNPCSVTLLVKGPNKHTLTQVKDAIRDGLRAIKNAIEDGCMVPGAGAIEVAMAEALVTYKNSIKGRARLGVQAFADALLIIPKVLAQNAGYDPQETLVKVQAEHVESKQLVGVDLNTGEPMVAADAGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLK Predict reactive species\nFull Name: chaperonin containing TCP1, subunit 6B (zeta 2)\nCalculated Molecular Weight: 530 aa, 58 kDa\nObserved Molecular Weight: 53-58 kDa\nGenBank Accession Number: BC027591\nGene Symbol: CCT6B\nGene ID (NCBI): 10693\nRRID: AB_2918712\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q92526\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888057700521,"sku":"67961-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67961-1-ig","provider":"Iright","version":"1.0","type":"link"}