{"product_id":"proteintech-67965-1-ig","title":"Proteintech, 67965-1-Ig, MFSD2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe MFSD2 (67965-1-Ig) by Proteintech is a Monoclonal antibody targeting MFSD2 in WB, ELISA applications with reactivity to human, mouse samples\n67965-1-Ig targets MFSD2 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue, human testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMFSD2, also named as MFSD2A, belongs to a large family of presumptive carbohydrate transporters with 10-12 membrane-spanning domains, is located at chromosomal position 1p34.2, and is conserved in evolution. It plays a role in thermogenesis via beta-adrenergic signaling pathway. It may be the main plasma membrane tunicamycin transporter. MFSD2 has three isoforms with MW 50 kDa and 59-60 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag31028 Product name: Recombinant human MFSD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 453-530 aa of BC092414 Sequence: AGYQTRGCSQPERVKFTLNMLVTMAPIVLILLGLLLFKMYPIDEERRRQNKKALQALRDEASSSGCSETDSTELASIL Predict reactive species\nFull Name: major facilitator superfamily domain containing 2\nCalculated Molecular Weight: 543 aa, 60 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC092414\nGene Symbol: MFSD2\nGene ID (NCBI): 84879\nRRID: AB_2918716\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8NA29\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888067563689,"sku":"67965-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67965-1-ig","provider":"Iright","version":"1.0","type":"link"}