{"product_id":"proteintech-67978-1-ig","title":"Proteintech, 67978-1-Ig, SPTBN1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPTBN1 (67978-1-Ig) by Proteintech is a Monoclonal antibody targeting SPTBN1 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat, rabbit, pig samples\n67978-1-Ig targets SPTBN1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat, rabbit, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse cerebellum tissue,  HepG2 cells,  Jurkat cells,  pig brain,  rabbit brain,  rat brain,  mouse brain,  rat cerebellum\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPTBN1 is the non-erythrocytic form of β-spectrin or β-fodrin. Spectrins are members of the superfamily of F-actin cross linking proteins that are important as scaffolding proteins for protein sorting, cell adhesion, and migration. Reduced expression of SPTBN1 has been found to correlate with shorter survival of patients with hepatocellular cancer, pancreatic cancer and other malignancies of the gastrointestinal tract, suggesting tumor suppression ability of this protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat, rabbit, pig\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag31713 Product name: Recombinant human SPTBN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 633-820 aa of BC137282 Sequence: EMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKE Predict reactive species\nFull Name: spectrin, beta, non-erythrocytic 1\nCalculated Molecular Weight: 2364 aa, 275 kDa\nObserved Molecular Weight: 250-275 kDa\nGenBank Accession Number: BC137282\nGene Symbol: SPTBN1\nGene ID (NCBI): 6711\nRRID: AB_2918727\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q01082\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888076542121,"sku":"67978-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67978-1-ig","provider":"Iright","version":"1.0","type":"link"}