{"product_id":"proteintech-67983-1-ig","title":"Proteintech, 67983-1-Ig, NFIX Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe NFIX (67983-1-Ig) by Proteintech is a Monoclonal antibody targeting NFIX in WB, IHC, ELISA applications with reactivity to Human, mouse, rat, pig, rabbit samples\n67983-1-Ig targets NFIX in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, A549 cells,  HeLa cells,  rat testis tissue,  rat brain tissue,  rabbit brain tissue,  mouse brain tissue\nPositive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNFIX, also named CTF, belongs to the CTF\/NF-I family. NFIX recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. NFIX is individually capable of activating transcription and replication.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat, pig, rabbit\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag31447 Product name: Recombinant human NFIX protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 246-400 aa of NM_001271043 Sequence: ADLESPSYYNINQVTLGRRSITSPPSTSTTKRPKSIDDSEMESPVDDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIRYHHHHGQDSL Predict reactive species\nFull Name: nuclear factor I\/X (CCAAT-binding transcription factor)\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 45kDa, 50kDa\nGenBank Accession Number: NM_001271043\nGene Symbol: NFIX\nGene ID (NCBI): 4784\nRRID: AB_2918732\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q14938\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888046723241,"sku":"67983-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67983-1-ig","provider":"Iright","version":"1.0","type":"link"}