{"product_id":"proteintech-68003-1-ig","title":"Proteintech, 68003-1-Ig, BCAS2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe BCAS2 (68003-1-Ig) by Proteintech is a Monoclonal antibody targeting BCAS2 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n68003-1-Ig targets BCAS2 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, LNCaP cells,  HeLa cells,  HEK-293 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBreast carcinoma amplified sequence 2 (BCAS2) is preferentially known as pre-mRNA splicing factor SPF27 and was originally characterized as an up-regulated gene by amplification in human breast cancer cells. BCAS2 has been shown to be involved in DNA damage repair through the replication protein A (RPA) complex.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag21309 Product name: Recombinant human BCAS2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-225 aa of BC005285 Sequence: MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF Predict reactive species\nFull Name: breast carcinoma amplified sequence 2\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC005285\nGene Symbol: BCAS2\nGene ID (NCBI): 10286\nRRID: AB_2918750\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O75934\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888102265001,"sku":"68003-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68003-1-ig","provider":"Iright","version":"1.0","type":"link"}