{"product_id":"proteintech-68014-1-ig","title":"Proteintech, 68014-1-Ig, RAB39B Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB39B (68014-1-Ig) by Proteintech is a Monoclonal antibody targeting RAB39B in WB, ELISA applications with reactivity to Human, mouse, rat, rabbit, pig samples\n68014-1-Ig targets RAB39B in WB, ELISA applications and shows reactivity with Human, mouse, rat, rabbit, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rabbit brain tissue, Jurkat cells,  LNCaP cells,  pig brain tissue,  mouse brain tissue,  pig cerebellum tissue,  mouse cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRAB39B is a member of the RAB GTPase family with a putative role in vesicle trafficking. RAB39B is predominantly expressed in neuronal cells and is localized to the endoplasmic reticulum, Golgi and trans‐Golgi recycling endosomes. Several reports suggested that RAB39B may regulate protein trafficking and the PI3K-AKT-mTOR pathway. Mutations in RAB39B are known to be associated with X-linked intellectual disability (XLID), Parkinson's disease, and autism.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat, rabbit, pig\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag27170 Product name: Recombinant human RAB39B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-213 aa of BC009714 Sequence: MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERRCLC Predict reactive species\nFull Name: RAB39B, member RAS oncogene family\nCalculated Molecular Weight: 213 aa, 25 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC009714\nGene Symbol: RAB39B\nGene ID (NCBI): 116442\nRRID: AB_2918760\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96DA2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888316469417,"sku":"68014-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68014-1-ig","provider":"Iright","version":"1.0","type":"link"}