{"product_id":"proteintech-68027-1-ig","title":"Proteintech, 68027-1-Ig, GNAO1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe GNAO1 (68027-1-Ig) by Proteintech is a Monoclonal antibody targeting GNAO1 in WB, IHC, IF-P, ELISA applications with reactivity to Mouse, Rat, Rabbit, Pig, Chicken, Human samples\n68027-1-Ig targets GNAO1 in WB, IHC, IF-P, ELISA applications and shows reactivity with Mouse, Rat, Rabbit, Pig, Chicken, Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, rabbit brain tissue,  rat brain tissue,  mouse brain tissue,  chicken brain tissue,  rat cerebellum tissue\nPositive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGNAO1 gene encodes the α subunit of heterotrimeric guanine nucleotide-binding protein (Gi protein), a membrane protein widely expressed in the central nervous system involved in signal transduction (PMID: 30642806). GNAO1 belongs to the G-alpha family and G(i\/o\/t\/z) subfamily. GNAO1 is highly expressed in brain and modulate neuronal excitability (PMID: 30838255). GNAO1 has 2 isoforms with the molecular mass of 40 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Mouse, Rat, Rabbit, Pig, Chicken, Human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag32045 Product name: Recombinant human GNAO1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-302 aa of BC030027 Sequence: MKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDAAAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY Predict reactive species\nFull Name: guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O\nCalculated Molecular Weight: 302 aa, 35 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC030027\nGene Symbol: GNAO1\nGene ID (NCBI): 2775\nRRID: AB_2918770\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P09471\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888280752297,"sku":"68027-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68027-1-ig","provider":"Iright","version":"1.0","type":"link"}