{"product_id":"proteintech-68033-1-ig","title":"Proteintech, 68033-1-Ig, CD35 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD35 (68033-1-Ig) by Proteintech is a Monoclonal antibody targeting CD35 in IHC, IF-P, ELISA applications with reactivity to human samples\n68033-1-Ig targets CD35 in IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue, human appendicitis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:550-1:2200\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD35, also known as complement receptor type 1 (CR1) or C3b\/C4b receptor, is a single-chain glycoprotein consisting of 30 repeating homologous protein domains known as short consensus repeats (~60 amino acids each) followed by transmembrane and cytoplasmic domains (PMID: 8765013). CD35 is variably expressed by granulocytes, monocytes, B cells, some T cells, erythrocytes, follicular dendritic cells, Langerhans cells, and glomerular podocytes (PMID: 19004497). CD35 acts as a receptor for C3b and C4b and plays important roles in the regulation of the complement cascade and clearance of immune complexes. A soluble form of CD35 has been found in plasma (PMID: 3156931). It has been reported that soluble CD35 is produced by a proteolytic cleavage in the C-terminal region of CD35 transmembrane domain (PMID: 9405292).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30268 Product name: Recombinant human CR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1740-1971 aa of NM_000573 Sequence: DEGFRLKGRSASHCVLAGMKALWNSSVPVCEQIFCPNPPAILNGRHTGTPFGDIPYGKEISYACDTHPDRGMTFNLIGESSIRCTSDPQGNGVWSSPAPRCELSVPAACPHPPKIQNGHYIGGHVSLYLPGMTISYICDPGYLLVGKGFIFCTDQGIWSQLDHYCKEVNCSFPLFMNGISKELEMKKVYHYGDYVTLKCEDGYTLEGSPWSQCQADDRWDPPLAKCTSRTHD Predict reactive species\nFull Name: complement component (3b\/4b) receptor 1 (Knops blood group)\nCalculated Molecular Weight: 224 kDa\nGenBank Accession Number: NM_000573\nGene Symbol: CR1\nGene ID (NCBI): 1378\nENSEMBL Gene ID: ENSG00000203710\nRRID: AB_2918775\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P17927\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888058028201,"sku":"68033-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68033-1-ig","provider":"Iright","version":"1.0","type":"link"}