{"product_id":"proteintech-68034-1-ig","title":"Proteintech, 68034-1-Ig, ADPGK Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADPGK (68034-1-Ig) by Proteintech is a Monoclonal antibody targeting ADPGK in WB, ELISA applications with reactivity to Human samples\n68034-1-Ig targets ADPGK in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  human placenta tissue,  LNCaP cells,  THP-1 cells,  Jurkat cells,  K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADP-dependent glucokinase (ADPGK) has frst been described 1994 in hyperthermophilic archaea as a novel glucose-phosphorylating enzyme dependent on ADP (adenosine diphosphate) instead of ATP (adenosine triphosphate). Highest ADPGK expression is found in immune cells of both myeloid and lymphoid lineages. Catalyzes the phosphorylation of D-glucose to D-glucose 6-phosphate using ADP as the phosphate donor. GDP and CDP can replace ADP, but with reduced efficiency (By similarity).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag31242 Product name: Recombinant human ADPGK protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 362-497 aa of BC006112 Sequence: ILKEHGRSKSRASDLTRIHFHTLVYHILATVDGHWANQLAAVAAGARVAGTQACATETIDTSRVSLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHPHY Predict reactive species\nFull Name: ADP-dependent glucokinase\nCalculated Molecular Weight: 497 aa, 54 kDa\nObserved Molecular Weight: 51 kDa\nGenBank Accession Number: BC006112\nGene Symbol: ADPGK\nGene ID (NCBI): 83440\nRRID: AB_2918776\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9BRR6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888085029033,"sku":"68034-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68034-1-ig","provider":"Iright","version":"1.0","type":"link"}