{"product_id":"proteintech-68043-1-ig","title":"Proteintech, 68043-1-Ig, Synaptotagmin-1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Synaptotagmin-1 (68043-1-Ig) by Proteintech is a Monoclonal antibody targeting Synaptotagmin-1 in WB, IHC, ELISA applications with reactivity to Human,  Mouse,  Rat,  Pig,  Rabbit,  Chicken samples\n68043-1-Ig targets Synaptotagmin-1 in WB, IHC, ELISA applications and shows reactivity with Human,  Mouse,  Rat,  Pig,  Rabbit,  Chicken samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, rat cerebellum tissue,  mouse cerebellum tissue,  rabbit brain tissue,  rat brain tissue,  mouse brain tissue,  chicken brain tissue,  rabbit cerebellum tissue\nPositive IHC detected in: mouse brain tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\nImmunohistochemistry (IHC): IHC : 1:2500-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (PMID: 8058779). SYT1 (synaptotagmin I) was firstly identified as a 65-kDa protein with a wide distribution in neuronal and neurosecretory tissue (PMID: 7298720). Calcium binding to SYT1 participates in triggering neurotransmitter release at the synapse (PMID: 11242035). In addition to regulating exocytosis, SYT1 has also been implicated in endocytosis and neurite outgrowth (PMID: 15492212; 11078930; 10336114).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat, Pig, Rabbit, Chicken\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6071 Product name: Recombinant human SYT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 97-422 aa of BC058917 Sequence: GGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK Predict reactive species\nFull Name: synaptotagmin I\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 60-65 kDa\nGenBank Accession Number: BC058917\nGene Symbol: Synaptotagmin-1\nGene ID (NCBI): 6857\nRRID: AB_2918785\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P21579\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888077066409,"sku":"68043-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68043-1-ig","provider":"Iright","version":"1.0","type":"link"}