{"product_id":"proteintech-68048-1-ig","title":"Proteintech, 68048-1-Ig, TPPP Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TPPP (68048-1-Ig) by Proteintech is a Monoclonal antibody targeting TPPP in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit, chicken samples\n68048-1-Ig targets TPPP in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, chicken samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, pig cerebellum tissue,  rabbit cerebellum tissue,  rat cerebellum tissue,  SH-SY5Y cells,  rabbit brain,  rat brain,  mouse brain,  chicken brain\nPositive IHC detected in: human lung tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Neuro-2a cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTPPP, also named as TPPP1, P24 and P25, belongs to the TPPP family. TPPP promotes in vitro the polymerization of tubulin into double-walled tubules and polymorphic aggregates or bundled stabilized microtubules blocks. When overexpressed, TPPP inhibits mitotic spindle assembly and nuclear envelope breakdown, apparently without affecting other cellular events.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit, chicken\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag19046 Product name: Recombinant human TPPP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-95 aa of BC131506 Sequence: MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTD Predict reactive species\nFull Name: tubulin polymerization promoting protein\nCalculated Molecular Weight: 219 aa, 24 kDa\nObserved Molecular Weight: 24-29 kDa\nGenBank Accession Number: BC131506\nGene Symbol: TPPP\nGene ID (NCBI): 11076\nRRID: AB_2918790\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O94811\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888332361897,"sku":"68048-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68048-1-ig","provider":"Iright","version":"1.0","type":"link"}