{"product_id":"proteintech-68071-1-ig","title":"Proteintech, 68071-1-Ig, STRA8 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe STRA8 (68071-1-Ig) by Proteintech is a Monoclonal antibody targeting STRA8 in WB, ELISA applications with reactivity to human, mouse, rabbit samples\n68071-1-Ig targets STRA8 in WB, IF, ELISA applications and shows reactivity with human, mouse, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue, rabbit testis tissue,  mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nStimulated by retinoic acid 8 (Stra8), one of genes induced by retinoic acid (RA), is required for the meiotic initiation of male spermatogenesis. Stimulated by Retinoic Acid Gene 8 (STRA8) protein has been proposed as the molecular effector of Retinoic Acid (RA) involved in meiosis-inductive activity. Stra8 is a 45-kDa vertebrate-specific gene, without significant homologous proteins, expressed in the cytoplasm and nuclei of germ cells between mitosis and meiosis and presents exclusively in the embryonic and postnatal gonads of mammals. (PMID: 30106128, PMID: 31253359)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rabbit\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29680 Product name: Recombinant human STRA8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 187-330 aa of NM_182489 Sequence: NLSEERKASLRQAWAQKHRGPATLAEACREPACAEGSVKDSGVDSQGASCSLVSTPEEILFEDAFDVASFLDKSEVPSTSSSSSVLASCNPENPEEKFQLYMQIINFFKGLSCANTQVKQEASFPVDEEMIMLQCTETFDDEDL Predict reactive species\nFull Name: stimulated by retinoic acid gene 8 homolog (mouse)\nCalculated Molecular Weight: 37 kDa\nObserved Molecular Weight: 43-60 kda\nGenBank Accession Number: NM_182489\nGene Symbol: STRA8\nGene ID (NCBI): 346673\nRRID: AB_2918812\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q7Z7C7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888033812649,"sku":"68071-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68071-1-ig","provider":"Iright","version":"1.0","type":"link"}