{"product_id":"proteintech-68083-1-ig","title":"Proteintech, 68083-1-Ig, GDAP1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe GDAP1 (68083-1-Ig) by Proteintech is a Monoclonal antibody targeting GDAP1 in WB, IHC, IF-P, ELISA applications with reactivity to Human, mouse, rat, rabbit, pig samples\n68083-1-Ig targets GDAP1 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, mouse, rat, rabbit, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, Rabbit brain tissue,  mouse brain tissue,  rat brain tissue\nPositive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGDAP1 is a member of the ganglioside-induced differentiation-associated protein family, which may play a role in a signal transduction pathway during neuronal development. Mutations in this gene have been associated with various forms of Charcot-Marie-Tooth Disease and neuropathy.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat, rabbit, pig\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28616 Product name: Recombinant human GDAP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-257 aa of BC024939 Sequence: MRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYERVLKRKTFNKVLGHVNNILISAVLPTAFRVAKKRAPKVLGTTLV Predict reactive species\nFull Name: ganglioside-induced differentiation-associated protein 1\nCalculated Molecular Weight: 358 aa, 41 kDa\nObserved Molecular Weight: 38-40 kDa\nGenBank Accession Number: BC024939\nGene Symbol: GDAP1\nGene ID (NCBI): 54332\nRRID: AB_2918820\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8TB36\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888279212201,"sku":"68083-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68083-1-ig","provider":"Iright","version":"1.0","type":"link"}