{"product_id":"proteintech-68113-1-ig","title":"Proteintech, 68113-1-Ig, ADAM8 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADAM8 (68113-1-Ig) by Proteintech is a Monoclonal antibody targeting ADAM8 in WB, FC, ELISA applications with reactivity to human, pig samples\n68113-1-Ig targets ADAM8 in WB, FC, ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue, HaCaT cells,  A431 cells,  pig stomach tissue,  pig pancreas tissue\nPositive FC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nFlow Cytometry (FC): FC : 0.80 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADAM8 is a type I transmembrane (TM) glycoprotein consisting of an N-terminal prodomain, followed by a metalloproteinase-, disintegrin (DIS)-, cysteine-rich-, epidermal growth factor (EGF)-like- and TM domain and a cytoplasmic tail. Expression levels of ADAM8 in normal tissue are typically low and limited to a few distinct cell types in the lymphatic organs as components of the immune system, the central nervous system, bone, and the lung. This antibody can be used to detect endogenous ADAM8 with an apparent molecular weight of 90 kDa (the calculated MW ). ADAM8 also can be detectable as a band with a molecular weight (MW) of 98 kDa, slightly larger than the calculated MW (90 kDa) (PMID:11050116).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17262 Product name: Recombinant human ADAM8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 145-494 aa of BC115404 Sequence: EGGEGGRHAVYQAEHLLQTAGTCGVSDDSLGSLLGPRTAAVFRPRPGDSLPSRETRYVELYVVVDNAEFQMLGSEAAVRHRVLEVVNHVDKLYQKLNFRVVLVGLEIWNSQDRFHVSPDPSVTLENLLTWQARQRTRRHLHDNVQLITGVDFTGTTVGFARVSAMCSHSSGAVNQDHSKNPVGVACTMAHEMGHNLGMDHDENVQGCRCQERFEAGRCIMAGSIGSSFPRMFSDCSQAYLESFLERPQSVCLANAPDLSHLVGGPVCGNLFVERGEQCDCGPPEDCRNRCCNSTTCQLAEGAQCAHGTCCQECKVKPAGELCRPKKDMCDLEEFCDGRHPECPEDAFQEN Predict reactive species\nFull Name: ADAM metallopeptidase domain 8\nCalculated Molecular Weight: 824 aa, 89 kDa\nObserved Molecular Weight: 90 kDa\nGenBank Accession Number: BC115404\nGene Symbol: ADAM8\nGene ID (NCBI): 101\nRRID: AB_2923642\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P78325\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888084799657,"sku":"68113-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68113-1-ig","provider":"Iright","version":"1.0","type":"link"}