{"product_id":"proteintech-68117-1-ig","title":"Proteintech, 68117-1-Ig, ME1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ME1 (68117-1-Ig) by Proteintech is a Monoclonal antibody targeting ME1 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n68117-1-Ig targets ME1 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, pig brain tissue,  HCT 116 cells,  LNCaP cells,  HeLa cells,  rabbit brain tissue,  rat brain tissue,  mouse brain tissue\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nME1(NADP-dependent malic enzyme) belongs to the malic enzymes family. This malic enzyme catalyzes the reversible oxidative decarboxylation of malate and is a link between the glycolytic pathway and the citric acid cycle. The reaction is L-malate plus NADP(+) to form pyruvate, CO(2), and NADPH.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag9916 Product name: Recombinant human ME1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 226-572 aa of BC025246 Sequence: DEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQ Predict reactive species\nFull Name: malic enzyme 1, NADP(+)-dependent, cytosolic\nCalculated Molecular Weight: 572 aa, 64 kDa\nObserved Molecular Weight: 55-64 kDa\nGenBank Accession Number: BC025246\nGene Symbol: ME1\nGene ID (NCBI): 4199\nRRID: AB_2923646\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P48163\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888067334313,"sku":"68117-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68117-1-ig","provider":"Iright","version":"1.0","type":"link"}