{"product_id":"proteintech-68144-1-ig","title":"Proteintech, 68144-1-Ig, NDUFV1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDUFV1 (68144-1-Ig) by Proteintech is a Monoclonal antibody targeting NDUFV1 in WB, IHC, ELISA applications with reactivity to Human, pig, rabbit, rat, mouse samples\n68144-1-Ig targets NDUFV1 in WB, IHC, ELISA applications and shows reactivity with Human, pig, rabbit, rat, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-12 cells, A549 cells,  4T1 cells,  pig heart tissue,  HeLa cells,  HEK-293 cells,  H9C2 cells,  rabbit heart tissue\nPositive IHC detected in: human lung cancer tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDUFV1(NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial) is also named as UQOR1,Complex I-51kD and belongs to the complex I 51 kDa subunit family. It is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. It has 2 isoforms produced by alternative splicing. Defects in NDUFV1 are a cause of Leigh syndrome (LS) and mitochondrial complex I deficiency (MT-C1D).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, pig, rabbit, rat, mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag32659 Product name: Recombinant human NDUFV1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 116-447 aa of BC015645 Sequence: NADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAGLIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELIEKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELE Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa\nCalculated Molecular Weight: 51 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC015645\nGene Symbol: NDUFV1\nGene ID (NCBI): 4723\nRRID: AB_2923668\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P49821\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888302477481,"sku":"68144-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68144-1-ig","provider":"Iright","version":"1.0","type":"link"}