{"product_id":"proteintech-68160-1-ig","title":"Proteintech, 68160-1-Ig, LANCL1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe LANCL1 (68160-1-Ig) by Proteintech is a Monoclonal antibody targeting LANCL1 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat, pig samples\n68160-1-Ig targets LANCL1 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells,  pig brain tissue,  rabbit brain tissue,  rat brain tissue,  mouse brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IF\/ICC detected in: U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLanCL1 ( also known as P40 or GRP69A), is homologous to bacterial lanthionine synthetase C (LanC) family, which is involved in the biosynthesis of antimicrobial peptides (lantibiotics). LanCL1 was identified as a reduced glutathione (GSH)-binding protein and primarily expressed in neural tissues and testis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag32665 Product name: Recombinant human LANCL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 100-399 aa of BC028685 Sequence: TKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL Predict reactive species\nFull Name: LanC lantibiotic synthetase component C-like 1 (bacterial)\nCalculated Molecular Weight: 399 aa, 45 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC028685\nGene Symbol: LANCL1\nGene ID (NCBI): 10314\nRRID: AB_2923679\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O43813\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888289566889,"sku":"68160-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68160-1-ig","provider":"Iright","version":"1.0","type":"link"}