{"product_id":"proteintech-68180-1-ig","title":"Proteintech, 68180-1-Ig, PSMB2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSMB2 (68180-1-Ig) by Proteintech is a Monoclonal antibody targeting PSMB2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n68180-1-Ig targets PSMB2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, SKOV-3 cells,  HeLa cells,  HEK-293 cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, HCT 116 cells,  PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPSMB2(proteasome subunit beta type-2) is also named as macropain subunit C7-I, proteasome component C7-I, multicatalytic endopeptidase complex subunit C7-I and belongs to the peptidase T1B family. It is involved in an ATP\/ubiquitin-dependent non-lysosomal proteolytic pathway. The up-regulation of PSMB2 may indicate the activated neuronal defensive mechanism in VAD(vitamin A depletion) brain regions, which may underlie the VAD-related psychosis behavior(PMID:21190828).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7308 Product name: Recombinant human PSMB2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-201 aa of BC000268 Sequence: MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS Predict reactive species\nFull Name: proteasome (prosome, macropain) subunit, beta type, 2\nCalculated Molecular Weight: 23 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC000268\nGene Symbol: PSMB2\nGene ID (NCBI): 5690\nRRID: AB_2935271\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P49721\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888314929321,"sku":"68180-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68180-1-ig","provider":"Iright","version":"1.0","type":"link"}