{"product_id":"proteintech-68187-1-ig","title":"Proteintech, 68187-1-Ig, PABPC4 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PABPC4 (68187-1-Ig) by Proteintech is a Monoclonal antibody targeting PABPC4 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, Mouse, Rat samples\n68187-1-Ig targets PABPC4 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, HSC-T6 cells,  NIH\/3T3 cells,  HeLa cells,  HEK-293 cells,  Jurkat cells,  K-562 cells\nPositive IHC detected in: human colon cancer tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPoly(A)-binding protein (PABP), a nucleocytoplasmic shuttling protein, has a fundamental role in promoting gene expression by enhancing mRNA translation and stability(PMID: 21940797). Poly(A)-binding protein 4 (PABPC4), one of the homologs of PABP, was initially identified as a human T-cell activation-induced protein. PABPC4 may also be involved in the regulation of protein translation in platelets and megakaryocytes or may participate in the binding or stabilization of polyadenylates in platelet dense granules(NCBI).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6813 Product name: Recombinant human PABPC4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 285-631 aa of BC065540 Sequence: QERISRYQGVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVMLEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRPPYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSAIRQSGPRPTLRHLAPTGNAPASRGLPTTTQRVGVPTAVQNLAPRAAVAAAAPRAVAPYKYASSVRSPHPAIQPLQAPQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHHAKKEAAQKVGAVAAATS Predict reactive species\nFull Name: poly(A) binding protein, cytoplasmic 4 (inducible form)\nCalculated Molecular Weight: 70 kDa\nObserved Molecular Weight: 71 kDa\nGenBank Accession Number: BC065540\nGene Symbol: PABPC4\nGene ID (NCBI): 8761\nRRID: AB_2935277\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q13310\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888308146345,"sku":"68187-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68187-1-ig","provider":"Iright","version":"1.0","type":"link"}