{"product_id":"proteintech-68193-1-ig","title":"Proteintech, 68193-1-Ig, RPAP1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RPAP1 (68193-1-Ig) by Proteintech is a Monoclonal antibody targeting RPAP1 in WB, ELISA, FC (Intra) applications with reactivity to Human, mouse, rat samples\n68193-1-Ig targets RPAP1 in WB, ELISA, FC (Intra) applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, mouse brain tissue,  HeLa cells,  HEK-293 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells,  rat brain tissue\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRNA polymerase II-associated protein 1 (RPAP1) encodes a nuclear 153-kDa protein, and forms an interface between the RNA polymerase II (RNAPII) enzyme and chaperone\/scaffolding protein, suggesting that it is required to connect RNA polymerase II to regulators of protein complex formation. RPAP1 is required for interaction of the RNA polymerase II complex with acetylated histone H3 and the subsequent DNA transcription.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7856 Product name: Recombinant human RPAP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-351 aa of BC000246 Sequence: MLSRPKPGESEVDLLHFQSQFLAAGAAPAVQLVKKGNRGGGDANSDRPPLQDHRDVVMLDNLPDLPPALVPSPPKRARPSPGHCLPEDEDPEERLRRHDQHITAVLTKIIERDTSSVAVNLPVPSGVAFPAVFLRSRDTQGKSATSGKRSIFAQEIAARRIAEAKGPSVGEVVPNVGPPEGAVTCETPTPRNQGCQLPGSSHSFQGPNLVTGKGLRDQEAEQEAQTIHEENIARLQAMAPEEILQEQQRLLAQLDPSLVAFLRSHSHTQEQTGETASEEQRPGGPSANVTKEEPLMSAFASEPRKRDKLEPEAPALALPVTPQKEWLHMDTVELEKLHWTQDLPPVRRQQT Predict reactive species\nFull Name: RNA polymerase II associated protein 1\nCalculated Molecular Weight: 153 kDa\nObserved Molecular Weight: 153 kDa\nGenBank Accession Number: BC000246\nGene Symbol: RPAP1\nGene ID (NCBI): 26015\nRRID: AB_2935282\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9BWH6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888319975593,"sku":"68193-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68193-1-ig","provider":"Iright","version":"1.0","type":"link"}