{"product_id":"proteintech-68197-1-ig","title":"Proteintech, 68197-1-Ig, VPS25 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe VPS25 (68197-1-Ig) by Proteintech is a Monoclonal antibody targeting VPS25 in WB, IF\/ICC, ELISA applications with reactivity to Human, Rabbit samples\n68197-1-Ig targets VPS25 in WB, IF\/ICC, ELISA applications and shows reactivity with Human, Rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  rabbit kidney tissue,  HepG2 cells,  Jurkat cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVPS25 is a component of the endosome-associated complex ESCRT-II (Endosomal Sorting Complexes Required for Transport protein II). ESCRT-II complex, composed of VPS25, VPS36,  and SNF8, functions in sorting of ubiquitinated membrane proteins during endocytosis. ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. VPS25 is highly conserved. Human VPS25 gene maps to chromosome 17q21.31 and is expressed in a wide range of tissues (PMID: 16889659).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Rabbit\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8243 Product name: Recombinant human VPS25 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-176 aa of BC006282 Sequence: MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF Predict reactive species\nFull Name: vacuolar protein sorting 25 homolog (S. cerevisiae)\nCalculated Molecular Weight: 176 aa, 21 kDa\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC006282\nGene Symbol: VPS25\nGene ID (NCBI): 84313\nRRID: AB_2935286\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9BRG1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888336130217,"sku":"68197-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68197-1-ig","provider":"Iright","version":"1.0","type":"link"}