{"product_id":"proteintech-68202-1-ig","title":"Proteintech, 68202-1-Ig, EIF3B Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe EIF3B (68202-1-Ig) by Proteintech is a Monoclonal antibody targeting EIF3B in WB, ELISA applications with reactivity to Human, mouse, rat samples\n68202-1-Ig targets EIF3B in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, A431 cells,  HeLa cells,  HEK-293 cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEIF3B, also named Eukaryotic translation initiation factor 3 subunit B, is an 814 amino acid protein, which contains 1 RRM (RNA recognition motif) domain and 8 WD repeats and belongs to the eIF-3 subunit B family. EIF3B as an RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation, and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression. The calculated molecular weight of EIF3B is 93 kDa, but the phosphorylated EIF3B protein is about 115 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag31427 Product name: Recombinant human EIF3B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 381-562 aa of BC001173 Sequence: FSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHCESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMK Predict reactive species\nFull Name: eukaryotic translation initiation factor 3, subunit B\nCalculated Molecular Weight: 93 kDa\nObserved Molecular Weight: 115 kDa\nGenBank Accession Number: BC001173\nGene Symbol: EIF3B\nGene ID (NCBI): 8662\nRRID: AB_2935290\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P55884\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888061436073,"sku":"68202-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68202-1-ig","provider":"Iright","version":"1.0","type":"link"}