{"product_id":"proteintech-68210-1-ig","title":"Proteintech, 68210-1-Ig, GSTM5 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe GSTM5 (68210-1-Ig) by Proteintech is a Monoclonal antibody targeting GSTM5 in WB, ELISA applications with reactivity to Human, mouse, rat, pig, rabbit samples\n68210-1-Ig targets GSTM5 in WB, ELISA applications and shows reactivity with Human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rabbit brain tissue, pig liver tissue,  rabbit liver tissue,  rat brain tissue,  mouse brain tissue,  mouse liver tissue,  mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGSTM5, Glutathione S-transferases, belongs to eukaryotic and prokaryotic phase II metabolic isozymes family. It can catalyze the conjugation of the reduced form of glutathione (GSH) to xenobiotic substrates for detoxification. GSTM5 undergo epigenetic repression in AMD (age-related macular degeneration) RPE\/choroid, which may increase susceptibility to oxidative stress in AMD retinas (PMID: 22410570). GSTM5 was found in brain, lung and testis (PMID: 9230131).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat, pig, rabbit\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6054 Product name: Recombinant human GSTM5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-218 aa of BC058881 Sequence: MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK Predict reactive species\nFull Name: glutathione S-transferase mu 5\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC058881\nGene Symbol: GSTM5\nGene ID (NCBI): 2949\nRRID: AB_2935298\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P46439\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888063959209,"sku":"68210-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68210-1-ig","provider":"Iright","version":"1.0","type":"link"}