{"product_id":"proteintech-68228-1-ig","title":"Proteintech, 68228-1-Ig, PGK2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PGK2 (68228-1-Ig) by Proteintech is a Monoclonal antibody targeting PGK2 in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig samples\n68228-1-Ig targets PGK2 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, human testis tissue,  HuH-7 cells,  Raji cells,  MOLT-4 cells,  pig heart tissue,  rat heart tissue\nPositive IHC detected in: rat testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\nPositive FC (Intra) detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:250-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPGK2, phosphoglycerate kinase 2, which belongs to the phosphoglycerate kinase superfamily. It catalyzes the first ATP-generating step in the central metabolic pathway of glycolysis, converting 1,3-bisphosphoglycerate and ADP to 3-phosphoglycerate and ATP.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag20631 Product name: Recombinant human PGK2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 242-360 aa of BC038843 Sequence: YTFLKVLNNMEIGASLFDEEGAKIVKDIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGPLGVFEWDAFAKGTKALMDEIV Predict reactive species\nFull Name: phosphoglycerate kinase 2\nCalculated Molecular Weight: 417 aa, 45 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC038843\nGene Symbol: PGK2\nGene ID (NCBI): 5232\nRRID: AB_2935316\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P07205\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888309883049,"sku":"68228-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68228-1-ig","provider":"Iright","version":"1.0","type":"link"}