{"product_id":"proteintech-68241-1-ig","title":"Proteintech, 68241-1-Ig, OPA3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe OPA3 (68241-1-Ig) by Proteintech is a Monoclonal antibody targeting OPA3 in WB, ELISA applications with reactivity to Human samples\n68241-1-Ig targets OPA3 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, K-562 cells,  A431 cells,  HEK-293 cells,  HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe OPA3 cDNA encodes a deduced 179-amino acid protein. Northern blot analysis demonstrated a primary transcript of approximately 5.0 kb that was ubiquitously expressed, most prominently in skeletal muscle and kidney. Mutations in this gene have been shown to result in 3-methylglutaconic aciduria type III and autosomal dominant optic atrophy and cataract.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8173 Product name: Recombinant human OPA3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 24-179 aa of BC005059 Sequence: ANRIKEAARRSEFFKTYICLPPAQLYHWVEMRTKMRIMGFRGTVIKPLNEEAAAELGAELLGEATIFIVGGGCLVLEYWRHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQAQVQAAPPQGALEELRTELQEVRAQLCNPGRSASHAVPASKK Predict reactive species\nFull Name: optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia)\nCalculated Molecular Weight: 179 aa, 20 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC005059\nGene Symbol: OPA3\nGene ID (NCBI): 80207\nRRID: AB_2935328\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9H6K4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888307589289,"sku":"68241-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68241-1-ig","provider":"Iright","version":"1.0","type":"link"}