{"product_id":"proteintech-68262-1-ig","title":"Proteintech, 68262-1-Ig, FUS\/TLS Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe FUS\/TLS (68262-1-Ig) by Proteintech is a Monoclonal antibody targeting FUS\/TLS in WB, IHC, IF-P, IF-Fro, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n68262-1-Ig targets FUS\/TLS in WB, IHC, IF-P, IF-Fro, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  Neuro-2a cells,  rat brain tissue,  HepG2 cells,  HEK-293 cells,  mouse brain tissue\nPositive IP detected in: K-562 cells\nPositive IHC detected in: rat brain tissue, human ovary tumor tissue,  human colon tissue,  mouse brain tissue,  mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\nPositive IF-Fro detected in: rat cerebellum tissue, mouse cerebellum tissue\nPositive FC (Intra) detected in: HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:5000-1:20000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFUS (also named TLS and POMp75) belongs to the RRM TET family. FUS may play a role in the maintenance of genomic integrity; it binds both single-stranded and double-stranded DNA and promotes ATP-independent annealing of complementary single-stranded DNAs and D-loop formation in superhelical double-stranded DNA. FUS is also an RNA-binding protein, and its links to neurodegenerative disease proffer the intriguing possibility that altered RNA metabolism or RNA processing may underlie or contribute to neuron degeneration[PMID: 22640227]. FUS may be a cause of angiomatoid fibrous histiocytoma (AFH) and is implicated in certain forms of amyotrophic lateral sclerosis (ALS) and frontotemporal dementias (FTDs) such as frontotemporal lobar dementia with ubiquitin inclusions (FTLD-U)(PMID: 22640227). Multiple phosphorylation on the N terminus of FUS caused that FUS was detected 68-75 kDa (PMID:24899704).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag2150 Product name: Recombinant human FUS\/TLS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 53-400 aa of BC026062 Sequence: SSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGG Predict reactive species\nFull Name: fusion (involved in t(12;16) in malignant liposarcoma)\nCalculated Molecular Weight: 75 kDa\nObserved Molecular Weight: 53 kDa, 68-75 kDa\nGenBank Accession Number: BC026062\nGene Symbol: FUS\/TLS\nGene ID (NCBI): 2521\nRRID: AB_2935347\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P35637\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888000684201,"sku":"68262-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68262-1-ig","provider":"Iright","version":"1.0","type":"link"}