{"product_id":"proteintech-68286-1-ig","title":"Proteintech, 68286-1-Ig, Raptor Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Raptor (68286-1-Ig) by Proteintech is a Monoclonal antibody targeting Raptor in WB, IP, ELISA applications with reactivity to Human samples\n68286-1-Ig targets Raptor in WB, IP, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, LNCaP cells,  HEK-293 cells,  MOLT-4 cells,  Jurkat cells,  HeLa cells,  K-562 cells\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRPTOR, also named as KIAA1303 and RAPTOR Belongs to the WD repeat RAPTOR family. It is involved in the control of the mammalian target of rapamycin complex 1 (mTORC1) activity which regulates cell growth and survival, and autophagy in response to nutrient and hormonal signals; functions as a scaffold for recruiting mTORC1 substrates. mTORC1 is activated in response to growth factors or amino-acids. Amino-acid-signaling to mTORC1 is mediated by Rag GTPases, which cause amino-acid-induced relocalization of mTOR within the endomembrane system. Activated mTORC1 up-regulates protein synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. mTORC1 phosphorylates EIF4EBP1 and releases it from inhibiting the elongation initiation factor 4E (eiF4E). mTORC1 phosphorylates and activates S6K1 at 'Thr-389', which then promotes protein synthesis by phosphorylating PDCD4 and targeting it for degradation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30131 Product name: Recombinant human KIAA1303 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1195-1335 aa of BC136654 Sequence: RRMALSECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQIVKGLTALDIHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEKRVR Predict reactive species\nFull Name: raptor\nCalculated Molecular Weight: 1335 aa, 149 kDa\nObserved Molecular Weight: 130-150 kDa\nGenBank Accession Number: BC136654\nGene Symbol: Raptor\nGene ID (NCBI): 57521\nRRID: AB_2935367\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8N122\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888048754857,"sku":"68286-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68286-1-ig","provider":"Iright","version":"1.0","type":"link"}