{"product_id":"proteintech-68315-1-ig","title":"Proteintech, 68315-1-Ig, EXOSC10 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe EXOSC10 (68315-1-Ig) by Proteintech is a Monoclonal antibody targeting EXOSC10 in WB, IF\/ICC, IP, ELISA applications with reactivity to human samples\n68315-1-Ig targets EXOSC10 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HeLa cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells\nPositive IP detected in: HeLa cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAbout 50% of patients with polymyositis\/scleroderma (PM-Scl) overlap syndrome are reported to have autoantibodies to a neuclear\/nucleolar particle termed PM-Scl. Exosome component 10 (EXOSC10), also named autoantigen PM\/Scl 2, is the 100 kDa antigen component of PM-Scl and is recognized by most sera of PM-Scl paitents. EXOSC10 is strongly enriched in the nucleolus and a small amount has been found in cytoplasm supporting the existence of a nucleolar RNA exosome complex form. As a putative catalytic component of the RNA exosome complex which has 3'-\u0026gt;5' exoribonuclease activity, EXOSC10 participates in a multitude of cellular RNA processing and degradation events.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28587 Product name: Recombinant human EXOSC10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 586-885 aa of BC039901 Sequence: VAAGVKKSGPLPSAERLENVLFGPHDCSHAPPDGYPIIPTSGSVPVQKQASLFPDEKEDNLLGTTCLIATAVITLFNEPSAEDSKKGPLTVAQKKAQNIMESFENPFRMFLPSLGHRAPVSQAAKFDPSTKIYEISNRWKLAQVQVQKDSKEAVKKKAAEQTAAREQAKEACKAAAEQAISVRQQVVLENAAKKRERATSDPRTTEQKQEKKRLKISKKPKDPEPPEKEFTPYDYSQSDFKAFAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRGFRYNWPQR Predict reactive species\nFull Name: exosome component 10\nCalculated Molecular Weight: 98 kDa\nObserved Molecular Weight: 98 kDa\nGenBank Accession Number: BC039901\nGene Symbol: EXOSC10\nGene ID (NCBI): 5394\nRRID: AB_2935392\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q01780\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888275869865,"sku":"68315-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68315-1-ig","provider":"Iright","version":"1.0","type":"link"}