{"product_id":"proteintech-68321-1-ig","title":"Proteintech, 68321-1-Ig, MTHFD1L Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe MTHFD1L (68321-1-Ig) by Proteintech is a Monoclonal antibody targeting MTHFD1L in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat, rabbit samples\n68321-1-Ig targets MTHFD1L in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, HEK-293 cells,  rabbit testis tissue,  rat testis tissue,  LNCaP cells,  HeLa cells,  HepG2 cells\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMTHFD1L(Monofunctional C1-tetrahydrofolate synthase, mitochondrial) is also named as FTHFSDC1(Formyltetrahydrofolate synthetase). MTHFD1L enzyme is present in mitochondria from normal embryonic tissues and embryonic fibroblast cell lines, and embryonic mitochondria possess the ability to synthesize formate from glycine. It catalyzes the final step in the mitochondrial conversion of 1-C units to formate in embryos. Moreover, MTHFD1L levels were substantially higher in embryonic mitochondria than in adult liver mitochondria and embryonic mitochondria exhibited greater formate production(PMID:19948730). It has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, rabbit\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag9061 Product name: Recombinant human MTHFD1L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 427-775 aa of BC017477 Sequence: GRMVVASDKSGQPVTADDLGVTGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSVLADKIALKLVGEEGFVVTEAGFGADIGMEKFFNIKCRASGLVPNVVVLVATVRALKMHGGGPSVTAGVPLKKEYTEENIQLVADGCCNLQKQIQITQLFGVPVVVALNVFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVDLARAVREAASKRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQGFGNLPICMAKTHLSLSHQPDKKGVPRDFILPISDVRASIGAGFIYPLVGTMSTMPGLPTRPCFYDIDLDTETEQVKGLF Predict reactive species\nFull Name: methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like\nCalculated Molecular Weight: 978 aa, 106 kDa\nObserved Molecular Weight: 106 kDa\nGenBank Accession Number: BC017477\nGene Symbol: MTHFD1L\nGene ID (NCBI): 25902\nRRID: AB_2935394\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q6UB35\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888295334057,"sku":"68321-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-68321-1-ig","provider":"Iright","version":"1.0","type":"link"}